ELISA Recombinant Thiobacillus ferrooxidans Mercuric resistance protein merC(merC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans)
Uniprot NO.:P22905
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAITRIIDKIGIVGTIVGSFSCAMCFPAAASLGAAIGLGFLSQWEGLFVQWLIPIFASV ALLATLAGWFSHRQWQRTLLGSIGPVLALVGVFGLTHHFLDKDLARVIFYTGLVVMFLVS IWDMVNPANRRCATDGCETPAPRS
Protein Names:Recommended name: Mercuric resistance protein merC
Gene Names:Name:merC
Expression Region:1-144
Sequence Info:fµLl length protein