Skip to Content

ELISA Recombinant Thiobacillus ferrooxidans Mercuric resistance protein merC(merC)

https://www.labonsite.com/web/image/product.template/159998/image_1920?unique=b3f4f0f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans) Uniprot NO.:P22905 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAITRIIDKIGIVGTIVGSFSCAMCFPAAASLGAAIGLGFLSQWEGLFVQWLIPIFASV ALLATLAGWFSHRQWQRTLLGSIGPVLALVGVFGLTHHFLDKDLARVIFYTGLVVMFLVS IWDMVNPANRRCATDGCETPAPRS Protein Names:Recommended name: Mercuric resistance protein merC Gene Names:Name:merC Expression Region:1-144 Sequence Info:fµLl length protein

1,487.00 € 1487.0 EUR 1,487.00 €

1,487.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days