Se rendre au contenu

ELISA Recombinant Mouse C-C chemokine receptor type 9(Ccr9)

https://www.labonsite.com/web/image/product.template/143970/image_1920?unique=2109108
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q9WUT7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSmLL ETTSGALSL Protein Names:Recommended name: C-C chemokine receptor type 9 Short name= C-C CKR-9 Short name= CC-CKR-9 Short name= CCR-9 Alternative name(s): Chemokine C-C receptor 10 CD_antigen= CDw199 Gene Names:Name:Ccr9 Synonyms:Cmkbr10 Expression Region:1-369 Sequence Info:fµLl length protein

1.724,00 € 1724.0 EUR 1.724,00 €

1.724,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables