ELISA Recombinant Lactobacillus sakei subsp. sakei Protein CrcB homolog 1(crcB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Lactobacillus sakei subsp. sakei (strain 23K) Uniprot NO.:Q38ZE5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKIKESLAVGSFAFFGGILRYLIGLVLNQPTGFPYGTLCVNLIGAFCLPFLMRYIVARLH LSDQLALAIGTGFFGAFTTFSSFSVDAIRLVNQQQWSAFAWYVGISMVGGVLLSLLADYW AVKLTHNPEEQEVSQ Protein Names:Recommended name: Protein CrcB homolog 1 Gene Names:Name:crcB1 Ordered Locus Names:LCA_0135 Expression Region:1-135 Sequence Info:fµLl length protein