Se rendre au contenu

ELISA Recombinant Alcanivorax borkumensis Alkane 1-monooxygenase 2(alkB2)

https://www.labonsite.com/web/image/product.template/115952/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) Uniprot NO.:Q0VTH3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFENTNPDVmLKMKKYGYLAFWAIMVPLVPFSAFVGVESGTQDYWAWFMYAFIFGIIPVL DYLVGKDPTNPSEDVQVPTMSEEVFYRVSAIAMGFVWIAVLFYAGHIFMNNGYGLLGKIG WIVSIGTVGGIIAINLGHELIHKDPKVENWMGGLLLSSVTYAGFKVEHVRGHHVHVSTPD DASSSRYNQSLYNFLPKAFVHNFINAWSLEKKYLERKGKKNISVHNELIWWYSISALFAA TFGLLWGWQGVVFFLGQSFFAALALEIINYIEHYGLHRRVNDKGRFERVTPAHSWNSNFL LTNLALFQLQRHSDHHAYAKRRYQVLRHYEESPQLPAGYATMYVLALIPPLWRKVMNPRV EAYYEGELDQLFRDGKRVNNIA Protein Names:Recommended name: Alkane 1-monooxygenase 2 EC= 1.14.15.3 Alternative name(s): Alkane hydroxylase Short name= AHs Terminal alkane hydroxylase Gene Names:Name:alkB2 Ordered Locus Names:ABO_0122 Expression Region:1-382 Sequence Info:fµLl length protein

1.738,00 € 1738.0 EUR 1.738,00 €

1.738,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables