ELISA Recombinant Cellvibrio japonicus Na(+)-translocating NADH-quinone reductase subunit E

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellµLosa) Uniprot NO.:B3PFQ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEHLLSLLVRSVFIENMALAFFLGMCSFLAMSKKINAAIGLGIAVIVVQTVTVPANNLLL TYLLKEDALAWAGVTGVDLTFLSFISFIGVIAAIVQIMEMVMDKYMPALYNALGVFLPLI TVNCVIMGGSLFMVERDYHFAESVVYGFGSGAGWAIAIVLLAGILEKMKYSDIPEGLRGL GITFITVGLMSLGFMSFGGISL Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E Gene Names:Name:nqrE Ordered Locus Names:CJA_1769 Expression Region:1-202 Sequence Info:fµLl length protein