Se rendre au contenu

ELISA Recombinant Flagellar biosynthetic protein fliP(fliP)

https://www.labonsite.com/web/image/product.template/112955/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 Uniprot NO.:P0AC06 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QLPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEKGAQPLREFmLRQ TREADLGLFARLANTGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLmLFVLVDGWQLLVGSLAQSFYS Protein Names:Recommended name: Flagellar biosynthetic protein fliP Gene Names:Name:fliP Ordered Locus Names:Z3038, ECs2687 Expression Region:22-245 Sequence Info:fµLl length protein

1.571,00 € 1571.0 EUR 1.571,00 €

1.571,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables