ELISA Recombinant Mouse Fms-related tyrosine kinase 3 ligand(Flt3lg)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P49772 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP Protein Names:Recommended name: Fms-related tyrosine kinase 3 ligand Short name= Flt3 ligand Short name= Flt3L Alternative name(s): SL cytokine Gene Names:Name:Flt3lg Synonyms:Flt3l Expression Region:27-232 Sequence Info:fµLl length protein