Skip to Content

ELISA Recombinant Helicobacter acinonychis NADH-quinone oxidoreductase subunit K(nuoK)

https://www.labonsite.com/web/image/product.template/128714/image_1920?unique=4552294
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Helicobacter acinonychis (strain Sheeba) Uniprot NO.:Q17Z62 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIGLNHYLIVSGLLFCIGLAGmLKRKNILLLFFSTEImLNAINIGFIAISKYIHNLDGQM FALFIIAIAASEVAIGLGLVILWFKKFKSLDIDSLNAMKG Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K Gene Names:Name:nuoK Ordered Locus Names:Hac_0214 Expression Region:1-100 Sequence Info:fµLl length protein

1,441.00 € 1441.0 EUR 1,441.00 €

1,441.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days