Skip to Content

ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_788163 (POPTRDRAFT_788163)

https://www.labonsite.com/web/image/product.template/150280/image_1920?unique=41ec440
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:B9NBE5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAPPAPSMVSRMTALFLRVLTFAFLMVSLVIMTTNTGTIEIGIDEFKVRSKDFYSYRYM LAAIAFGLTYTILQIALTLNHISKRNGAQTSGDGNLVFDFYGDKVVSYILATGAAAAFGA TKELKTQLAGLGGDKFFNKGYASASLLLLGFVCTAILSVFSSYALPKKV Protein Names:Recommended name: CASP-like protein POPTRDRAFT_788163 Gene Names:ORF Names:POPTRDRAFT_788163 Expression Region:1-169 Sequence Info:fµLl length protein

1,513.00 € 1513.0 EUR 1,513.00 €

1,513.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days