Skip to Content

ELISA Recombinant Candida albicans Squalene synthase(ERG9)

https://www.labonsite.com/web/image/product.template/121397/image_1920?unique=7485b17
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Candida albicans (Yeast) Uniprot NO.:P78589 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKFLQLLSHPTELKAVIQLFGFRQPLHPGKRDVNDKELGRCYELLNLTSRSFAAVIEEL HPELRDAVMIFYLVLRALDTIEDDMTIKSSIKIPLLREFDTKLNTKNWTFDGYGPNEKDR TVLVEFDKILNVYHRLKPQYQDIIKSITFKMGNGMADYILDEEFNVYGVATVEDYNLYCH YVAGLVGEGLTNLFVLANFGDKTLTENNFAKADSMGLFLQKTNIIRDYHEDLQDGRSFWP REIWSKYTENLQDFHKVKTPAKEFAGVSCINELVLNALGHVTDCLDYLSLVKDPSSFSFC AIPQVMAVATLAEVYNNPKVLHGVVKIRKGTTCRLILESRTLPGVVKIFKEYIQVINHKS SVRDPNYLKIGIKCGEIEQYCEMIYPNKQALPPSMKSLPENKFTKIVASRESIDLSVQRR IEPGNFNCNVVLFGIGALILSLIYFVLY Protein Names:Recommended name: Squalene synthase Short name= SQS Short name= SS EC= 2.5.1.21 Alternative name(s): FPP:FPP farnesyltransferase Farnesyl-diphosphate farnesyltransferase Gene Names:Name:ERG9 Expression Region:1-448 Sequence Info:fµLl length protein

1,808.00 € 1808.0 EUR 1,808.00 €

1,808.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days